Trust score
Probably legitimate
In summary, perfectchimneysweepsayreville.com is probably not a scam but legit.
Overview
Key findings from our automated analysis.
- We found a valid SSL certificate
- DNSFilter labels this site as safe
- The identity of the owner of the website is h… The identity of the owner of the website is hidden on WHOIS
- The Tranco rank The Tranco rank (how much traffic) is rather low
- The registrar of this website is popular amon… The registrar of this website is popular amongst scammers
- The age of this site is The age of this site is (very) young.
Score by criteria
How each factor feeds into the overall rating.
Detailed analysis
Domain information
Ownership details for perfectchimneysweepsayreville.com are masked behind a privacy service, which is common but makes the operator harder to hold to account.
- Created
- 4 March 2026
- Last updated
- 4 March 2026
- Renews
- 4 March 2027
- Registrant
- Redacted for privacy
- Organisation
- Privacy service provided by Withheld for Privacy ehf
- Contact
- [email protected]
Hosting & certificate
Where the site is served from, and who vouches for its encryption.
- Registrant country
- IS
- Certificate issuer
- Let's Encrypt
- Validation level
- Domain Validated (DV)
- Certificate state
- Valid
- Response speed
- Very fast
What the site presents
Content and metadata read from the page at scan time.
- Page title
- Perfect Chimney Sweep Sayreville | Expert Cleaning!
- Description
- Keep your chimney safe and efficient with Perfect Chimney Sweep Sayreville. We offer expert chimney cleaning, inspection, and repair services. Call today!
What we flagged
These findings reduced the final score.
- Finding 1
- The identity of the owner of the website is hidden on WHOIS
- Finding 2
- The Tranco rank (how much traffic) is rather low
- Finding 3
- The registrar of this website is popular amongst scammers
- Finding 4
- The age of this site is (very) young.
Analysis findings
What our scanner recorded, most significant first.
- The identity of the owner of the website is hidden on WHOIS Caution
- The Tranco rank (how much traffic) is rather low Caution
- The registrar of this website is popular amongst scammers Caution
Trust history
How the score moved over the past year.
Notable events
-
28 August 2026
Score: 66/100
Latest analysis
-
4 March 2026
WHOIS record updated
-
4 March 2026
Domain registered
Similar sites
Other .com domains that scored well.
How is this score calculated?
Our score draws on technical, reputational and behavioural signals gathered when we scanned the site. Each one is weighted by how much it affects safety and reliability. The final score runs from 0 to 100.