perfectchimneysweepsayreville.com

Full analysis and trust score for this domain

  • Scanned 2 weeks ago
  • HTTPS
  • Helpdesk
  • Amazon Phishing
Last analysis

Trust score

Probably legitimate

In summary, perfectchimneysweepsayreville.com is probably not a scam but legit.

4 risk signals were detected — see the findings below.

Overview

Key findings from our automated analysis.

  • We found a valid SSL certificate
  • DNSFilter labels this site as safe
  • The identity of the owner of the website is h… The identity of the owner of the website is hidden on WHOIS
  • The Tranco rank The Tranco rank (how much traffic) is rather low
  • The registrar of this website is popular amon… The registrar of this website is popular amongst scammers
  • The age of this site is The age of this site is (very) young.

Score by criteria

How each factor feeds into the overall rating.

Technical certificate
78 / 100
Reputation
72 / 100
Transparency
48 / 100
Popularity
68 / 100
Domain history
34 / 100
Findings balance
33 / 100

Detailed analysis

Domain information

Ownership details for perfectchimneysweepsayreville.com are masked behind a privacy service, which is common but makes the operator harder to hold to account.

Created
4 March 2026
Last updated
4 March 2026
Renews
4 March 2027
Registrant
Redacted for privacy
Organisation
Privacy service provided by Withheld for Privacy ehf

Analysis findings

What our scanner recorded, most significant first.

  • The identity of the owner of the website is hidden on WHOIS Caution
  • The Tranco rank (how much traffic) is rather low Caution
  • The registrar of this website is popular amongst scammers Caution

Trust history

How the score moved over the past year.

66 Aug 2026

Notable events

  1. 28 August 2026

    Score: 66/100

    Latest analysis

  2. 4 March 2026

    WHOIS record updated

  3. 4 March 2026

    Domain registered

Similar sites

Other .com domains that scored well.