Trust score
Very high risk
In summary, the trust score of megavalenciarealtycapitals.info is extremely low. This is a strong indicator that the website may be a scam.
Overview
Key findings from our automated analysis.
- We found a valid SSL certificate
- DNSFilter labels this site as safe
- The Tranco rank The Tranco rank (how much traffic) is rather low
- The server of the site has several low review… The server of the site has several low reviewed other websites
- This website seems for sale at this time This website seems for sale at this time (how to get your money back)
- This website was reported by IPQS for phishing This website was reported by IPQS for phishing.
- This website has been classified as suspiciou… This website has been classified as suspicious by IPQS
Score by criteria
How each factor feeds into the overall rating.
Detailed analysis
Domain information
Ownership details for megavalenciarealtycapitals.info are masked behind a privacy service, which is common but makes the operator harder to hold to account.
- Registrant
- Redacted for privacy
Hosting & certificate
Where the site is served from, and who vouches for its encryption.
- Certificate issuer
- Let's Encrypt
- Validation level
- Domain Validated (DV)
- Certificate state
- Valid
- Response speed
- Average
What the site presents
Content and metadata read from the page at scan time.
- Page title
- porkbun.com | domain for sale
What we flagged
These findings reduced the final score.
- Finding 1
- The Tranco rank (how much traffic) is rather low
- Finding 2
- The server of the site has several low reviewed other websites
- Finding 3
- This website seems for sale at this time (how to get your money back)
- Finding 4
- This website was reported by IPQS for phishing.
- Finding 5
- This website has been classified as suspicious by IPQS
Analysis findings
What our scanner recorded, most significant first.
- The Tranco rank (how much traffic) is rather low Caution
- The server of the site has several low reviewed other websites Caution
- This website seems for sale at this time (how to get your money back) Caution
Trust history
How the score moved over the past year.
Notable events
-
21 August 2026
Score: 5/100
Latest analysis
Similar sites
Other .info domains that scored well.
How is this score calculated?
Our score draws on technical, reputational and behavioural signals gathered when we scanned the site. Each one is weighted by how much it affects safety and reliability. The final score runs from 0 to 100.