megavalenciarealtycapitals.info

Full analysis and trust score for this domain

  • Scanned 3 weeks ago
  • HTTPS
  • Parked Domain
Last analysis

Trust score

Very high risk

In summary, the trust score of megavalenciarealtycapitals.info is extremely low. This is a strong indicator that the website may be a scam.

5 risk signals were detected — see the findings below.

Overview

Key findings from our automated analysis.

  • We found a valid SSL certificate
  • DNSFilter labels this site as safe
  • The Tranco rank The Tranco rank (how much traffic) is rather low
  • The server of the site has several low review… The server of the site has several low reviewed other websites
  • This website seems for sale at this time This website seems for sale at this time (how to get your money back)
  • This website was reported by IPQS for phishing This website was reported by IPQS for phishing.
  • This website has been classified as suspiciou… This website has been classified as suspicious by IPQS

Score by criteria

How each factor feeds into the overall rating.

Technical certificate
78 / 100
Reputation
1 / 100
Transparency
34 / 100
Popularity
53 / 100
Domain history
45 / 100
Findings balance
29 / 100

Detailed analysis

Domain information

Ownership details for megavalenciarealtycapitals.info are masked behind a privacy service, which is common but makes the operator harder to hold to account.

Registrant
Redacted for privacy

Analysis findings

What our scanner recorded, most significant first.

  • The Tranco rank (how much traffic) is rather low Caution
  • The server of the site has several low reviewed other websites Caution
  • This website seems for sale at this time (how to get your money back) Caution

Trust history

How the score moved over the past year.

5 Aug 2026

Notable events

  1. 21 August 2026

    Score: 5/100

    Latest analysis

Similar sites

Other .info domains that scored well.