Trust score
Very high risk
In summary, gcashivannaalawiifamilyghcghhcf.blogspot[..] has a very low trust score which indicates that there is a strong likelyhood the website is a scam. Be very careful when using this website!
Overview
Key findings from our automated analysis.
- The SSL certificate is valid
- This website is This website is (very) old
- This website is safe according to DNSFilter
- The owner of the website is using a service t… The owner of the website is using a service to hide their identity on WHOIS
- According to Tranco this site has a low rank
- This site is a website within another website
- This website uses a generic platform to host … This website uses a generic platform to host its website
Score by criteria
How each factor feeds into the overall rating.
Detailed analysis
Domain information
Ownership details for gcashivannaalawiifamilyghcghhcf.blogspot.com are masked behind a privacy service, which is common but makes the operator harder to hold to account.
- Created
- 31 July 2000
- Last updated
- 29 June 2026
- Renews
- 31 July 2027
- Registrant
- Redacted for privacy
- Organisation
- Google LLC
- Contact
- select request email form at https://domains.markmonitor.com/whois/blogspot.com
Hosting & certificate
Where the site is served from, and who vouches for its encryption.
- Registrant country
- US
- Certificate issuer
- Google Trust Services
- Validation level
- Domain Validated (DV)
- Certificate state
- Valid
- Response speed
- Average
What the site presents
Content and metadata read from the page at scan time.
- Page title
- Ivana Alawi Espesyal sa Facebook
What we flagged
These findings reduced the final score.
- Finding 1
- The owner of the website is using a service to hide their identity on WHOIS
- Finding 2
- According to Tranco this site has a low rank
- Finding 3
- This site is a website within another website
- Finding 4
- This website uses a generic platform to host its website
Analysis findings
What our scanner recorded, most significant first.
- The owner of the website is using a service to hide their identity on WHOIS Caution
- According to Tranco this site has a low rank Caution
- This site is a website within another website Caution
Trust history
How the score moved over the past year.
Notable events
-
3 September 2026
Score: 1/100
Latest analysis
-
29 June 2026
WHOIS record updated
-
31 July 2000
Domain registered
Similar sites
Other .com domains that scored well.
How is this score calculated?
Our score draws on technical, reputational and behavioural signals gathered when we scanned the site. Each one is weighted by how much it affects safety and reliability. The final score runs from 0 to 100.