gcashivannaalawiifamilyghcghhcf.blogspot.com

Full analysis and trust score for this domain

  • Scanned 1 week ago
  • HTTPS
  • Registration Possible
  • Industry - Media - Books
Last analysis

Trust score

Very high risk

In summary, gcashivannaalawiifamilyghcghhcf.blogspot[..] has a very low trust score which indicates that there is a strong likelyhood the website is a scam. Be very careful when using this website!

4 risk signals were detected — see the findings below.

Overview

Key findings from our automated analysis.

  • The SSL certificate is valid
  • This website is This website is (very) old
  • This website is safe according to DNSFilter
  • The owner of the website is using a service t… The owner of the website is using a service to hide their identity on WHOIS
  • According to Tranco this site has a low rank
  • This site is a website within another website
  • This website uses a generic platform to host … This website uses a generic platform to host its website

Score by criteria

How each factor feeds into the overall rating.

Technical certificate
78 / 100
Reputation
1 / 100
Transparency
40 / 100
Popularity
60 / 100
Domain history
92 / 100
Findings balance
43 / 100

Detailed analysis

Domain information

Ownership details for gcashivannaalawiifamilyghcghhcf.blogspot.com are masked behind a privacy service, which is common but makes the operator harder to hold to account.

Created
31 July 2000
Last updated
29 June 2026
Renews
31 July 2027
Registrant
Redacted for privacy
Organisation
Google LLC
Contact
select request email form at https://domains.markmonitor.com/whois/blogspot.com

Analysis findings

What our scanner recorded, most significant first.

  • The owner of the website is using a service to hide their identity on WHOIS Caution
  • According to Tranco this site has a low rank Caution
  • This site is a website within another website Caution

Trust history

How the score moved over the past year.

1 Sep 2026

Notable events

  1. 3 September 2026

    Score: 1/100

    Latest analysis

  2. 29 June 2026

    WHOIS record updated

  3. 31 July 2000

    Domain registered

Similar sites

Other .com domains that scored well.