facebook-settings-winverifyrewardlinkclaimrewardnow.ph

Full analysis and trust score for this domain

  • Scanned 2 weeks ago
Last analysis

Trust score

Likely trustworthy

In summary, It seems that facebook-settings-winverifyrewardlinkcla[..] is legit and safe to use and not a scam website.

4 risk signals were detected — see the findings below.

Overview

Key findings from our automated analysis.

  • DNSFilter considers this website safe
  • This website does not have many visitors
  • We did not find a SSL certificate
  • IPQS flagged this website for Phishing
  • IPQS has flagged this website as suspicious

Score by criteria

How each factor feeds into the overall rating.

Technical certificate
12 / 100
Reputation
100 / 100
Transparency
34 / 100
Popularity
54 / 100
Domain history
45 / 100
Findings balance
20 / 100

Detailed analysis

Domain information

Ownership details for facebook-settings-winverifyrewardlinkclaimrewardnow.ph are masked behind a privacy service, which is common but makes the operator harder to hold to account.

Registrant
Redacted for privacy

Analysis findings

What our scanner recorded, most significant first.

  • This website does not have many visitors Caution
  • We did not find a SSL certificate Caution
  • IPQS flagged this website for Phishing Caution

Trust history

How the score moved over the past year.

100 Aug 2026

Notable events

  1. 28 August 2026

    Score: 100/100

    Latest analysis

Similar sites

Other .ph domains that scored well.