Trust score
Likely trustworthy
In summary, It seems that facebook-settings-winverifyrewardlinkcla[..] is legit and safe to use and not a scam website.
Overview
Key findings from our automated analysis.
- DNSFilter considers this website safe
- This website does not have many visitors
- We did not find a SSL certificate
- IPQS flagged this website for Phishing
- IPQS has flagged this website as suspicious
Score by criteria
How each factor feeds into the overall rating.
Detailed analysis
Domain information
Ownership details for facebook-settings-winverifyrewardlinkclaimrewardnow.ph are masked behind a privacy service, which is common but makes the operator harder to hold to account.
- Registrant
- Redacted for privacy
Hosting & certificate
Where the site is served from, and who vouches for its encryption.
- Certificate state
- Invalid or missing
- Response speed
- Very fast
What the site presents
Content and metadata read from the page at scan time.
- Page title
- Redirecting...
What we flagged
These findings reduced the final score.
- Finding 1
- This website does not have many visitors
- Finding 2
- We did not find a SSL certificate
- Finding 3
- IPQS flagged this website for Phishing
- Finding 4
- IPQS has flagged this website as suspicious
Analysis findings
What our scanner recorded, most significant first.
- This website does not have many visitors Caution
- We did not find a SSL certificate Caution
- IPQS flagged this website for Phishing Caution
Trust history
How the score moved over the past year.
Notable events
-
28 August 2026
Score: 100/100
Latest analysis
Similar sites
Other .ph domains that scored well.
How is this score calculated?
Our score draws on technical, reputational and behavioural signals gathered when we scanned the site. Each one is weighted by how much it affects safety and reliability. The final score runs from 0 to 100.