dammavyaparakendramarketing.in

Full analysis and trust score for this domain

  • Scanned 3 weeks ago
  • HTTPS
  • Language - English
  • Brands
Last analysis

Trust score

Probably legitimate

In summary, dammavyaparakendramarketing.in is probably not a scam but legit.

3 risk signals were detected — see the findings below.

Overview

Key findings from our automated analysis.

  • We found a valid SSL certificate
  • DNSFilter labels this site as safe
  • The identity of the owner of the website is h… The identity of the owner of the website is hidden on WHOIS
  • The Tranco rank The Tranco rank (how much traffic) is rather low
  • The age of this site is The age of this site is (very) young.

Score by criteria

How each factor feeds into the overall rating.

Technical certificate
78 / 100
Reputation
72 / 100
Transparency
48 / 100
Popularity
60 / 100
Domain history
31 / 100
Findings balance
40 / 100

Detailed analysis

Domain information

Ownership details for dammavyaparakendramarketing.in are masked behind a privacy service, which is common but makes the operator harder to hold to account.

Created
12 July 2026
Last updated
17 July 2026
Renews
12 July 2027
Registrant
Redacted for privacy
Organisation
ASK hosiries
Contact
please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.

Analysis findings

What our scanner recorded, most significant first.

  • The identity of the owner of the website is hidden on WHOIS Caution
  • The Tranco rank (how much traffic) is rather low Caution
  • The age of this site is (very) young. Caution

Trust history

How the score moved over the past year.

66 Aug 2026

Notable events

  1. 21 August 2026

    Score: 66/100

    Latest analysis

  2. 17 July 2026

    WHOIS record updated

  3. 12 July 2026

    Domain registered

Similar sites

Other .in domains that scored well.