Trust score
Probably legitimate
In summary, dammavyaparakendramarketing.in is probably not a scam but legit.
Overview
Key findings from our automated analysis.
- We found a valid SSL certificate
- DNSFilter labels this site as safe
- The identity of the owner of the website is h… The identity of the owner of the website is hidden on WHOIS
- The Tranco rank The Tranco rank (how much traffic) is rather low
- The age of this site is The age of this site is (very) young.
Score by criteria
How each factor feeds into the overall rating.
Detailed analysis
Domain information
Ownership details for dammavyaparakendramarketing.in are masked behind a privacy service, which is common but makes the operator harder to hold to account.
- Created
- 12 July 2026
- Last updated
- 17 July 2026
- Renews
- 12 July 2027
- Registrant
- Redacted for privacy
- Organisation
- ASK hosiries
- Contact
- please query the rdds service of the registrar of record identified in this output for information on how to contact the registrant, admin, or tech contact of the queried domain name.
Hosting & certificate
Where the site is served from, and who vouches for its encryption.
- Registrant country
- IN
- Certificate issuer
- Let's Encrypt
- Validation level
- Domain Validated (DV)
- Certificate state
- Valid
- Response speed
- Average
What the site presents
Content and metadata read from the page at scan time.
- Page title
- - ClothingStore_Project
What we flagged
These findings reduced the final score.
- Finding 1
- The identity of the owner of the website is hidden on WHOIS
- Finding 2
- The Tranco rank (how much traffic) is rather low
- Finding 3
- The age of this site is (very) young.
Analysis findings
What our scanner recorded, most significant first.
- The identity of the owner of the website is hidden on WHOIS Caution
- The Tranco rank (how much traffic) is rather low Caution
- The age of this site is (very) young. Caution
Trust history
How the score moved over the past year.
Notable events
-
21 August 2026
Score: 66/100
Latest analysis
-
17 July 2026
WHOIS record updated
-
12 July 2026
Domain registered
Similar sites
Other .in domains that scored well.
How is this score calculated?
Our score draws on technical, reputational and behavioural signals gathered when we scanned the site. Each one is weighted by how much it affects safety and reliability. The final score runs from 0 to 100.