Trust score
Doubtful
In summary, checkvalenciarealtycapitals.info might be a scam. We found several indicators for this.
Overview
Key findings from our automated analysis.
- The SSL certificate is valid
- This website is safe according to DNSFilter
- According to Tranco this site has a low rank
- High number of suspicious websites on this se… High number of suspicious websites on this server
- This website seems to be parked This website seems to be parked (how to get your money back)
Score by criteria
How each factor feeds into the overall rating.
Detailed analysis
Domain information
Ownership details for checkvalenciarealtycapitals.info are masked behind a privacy service, which is common but makes the operator harder to hold to account.
- Registrant
- Redacted for privacy
Hosting & certificate
Where the site is served from, and who vouches for its encryption.
- Certificate issuer
- Let's Encrypt
- Validation level
- Domain Validated (DV)
- Certificate state
- Valid
- Response speed
- Fast
What the site presents
Content and metadata read from the page at scan time.
- Page title
- porkbun.com | domain for sale
What we flagged
These findings reduced the final score.
- Finding 1
- According to Tranco this site has a low rank
- Finding 2
- High number of suspicious websites on this server
- Finding 3
- This website seems to be parked (how to get your money back)
Analysis findings
What our scanner recorded, most significant first.
- According to Tranco this site has a low rank Caution
- High number of suspicious websites on this server Caution
- This website seems to be parked (how to get your money back) Caution
Trust history
How the score moved over the past year.
Notable events
-
21 August 2026
Score: 45/100
Latest analysis
Similar sites
Other .info domains that scored well.
How is this score calculated?
Our score draws on technical, reputational and behavioural signals gathered when we scanned the site. Each one is weighted by how much it affects safety and reliability. The final score runs from 0 to 100.