checkvalenciarealtycapital.info

Full analysis and trust score for this domain

  • Scanned 3 weeks ago
  • HTTPS
  • Parked Domain
Last analysis

Trust score

Doubtful

In summary, checkvalenciarealtycapital.info might be a scam. We found several indicators for this.

3 risk signals were detected — see the findings below.

Overview

Key findings from our automated analysis.

  • The SSL certificate is valid
  • This website is safe according to DNSFilter
  • According to Tranco this site has a low rank
  • High number of suspicious websites on this se… High number of suspicious websites on this server
  • This website seems to be parked This website seems to be parked (how to get your money back)

Score by criteria

How each factor feeds into the overall rating.

Technical certificate
78 / 100
Reputation
41 / 100
Transparency
34 / 100
Popularity
49 / 100
Domain history
45 / 100
Findings balance
40 / 100

Detailed analysis

Domain information

Ownership details for checkvalenciarealtycapital.info are masked behind a privacy service, which is common but makes the operator harder to hold to account.

Registrant
Redacted for privacy

Analysis findings

What our scanner recorded, most significant first.

  • According to Tranco this site has a low rank Caution
  • High number of suspicious websites on this server Caution
  • This website seems to be parked (how to get your money back) Caution

Trust history

How the score moved over the past year.

45 Aug 2026

Notable events

  1. 21 August 2026

    Score: 45/100

    Latest analysis

Similar sites

Other .info domains that scored well.